Skip to product information
1 of 1

Gene Bio Systems

Recombinant Treponema pallidum UPF0092 membrane protein TP_0409.1 (TP_0409.1)

Recombinant Treponema pallidum UPF0092 membrane protein TP_0409.1 (TP_0409.1)

SKU:CSB-CF349709TPR

Regular price $1,724.00 USD
Regular price Sale price $1,724.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Treponema pallidum (strain Nichols)

Uniprot NO.:P58007

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCPARSRMKTMPHRTLLQITTANGGWIPPLAIGVVCLIFYLFVFAPNLREQKRTQALIKN IKKGDPVVTIGGIHGVVSVVREHSLVIKVNEHGTLEVSRSAIARINDRRGVSNPKTDCDS KPGVPLTGVDKEIAR

Protein Names:Recommended name: UPF0092 membrane protein TP_0409.1

Gene Names:Ordered Locus Names:TP_0409.1

Expression Region:1-135

Sequence Info:full length protein

View full details