Gene Bio Systems
Recombinant Thermus thermophilus NADH-quinone oxidoreductase subunit 11(nqo11)
Recombinant Thermus thermophilus NADH-quinone oxidoreductase subunit 11(nqo11)
SKU:CSB-CF684918TNT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Uniprot NO.:Q56226
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMV IAVAAAEVAVGLGLIVAIFRHRESTAVDDLSELRG
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit 11 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I chain 11 NDH-1 subunit 11
Gene Names:Name:nqo11 Ordered Locus Names:TTHA0094
Expression Region:1-95
Sequence Info:full length protein
