Recombinant Thermotoga neapolitana Endonuclease V (nfi)

SKU: B9K7P3

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: B9K7P3

Gene Names: nfi

Alternative Name(s): Deoxyinosine 3'endonuclease ;Deoxyribonuclease V

Abbreviation: Recombinant Thermotoga neapolitana nfi protein

Organism: Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)

Source: Yeast

Expression Region: 1-225aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MTYKKLHEWDLSPEEAMKIQNVLREKILFKPFEGEPKYVAGVDLSFPKREEGLAVIVVMEYPTFKIVELVSERGKVDFPYIPGLLAFREGPLFLKAWEKLKTKPDVVVFDGQGIAHPRKLGIASHMGLFIEIPTIGVAKSRLYGTYREPENRRCSWSYLYDNEEIIGCVMRTREGSAPIFVSPGHLIDVESSIRLVKSFTLPGRRLPEPTRMAHIYTQRLKKGLF

MW: 27.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA.

Reference:

Function: