Gene Bio Systems
Recombinant Thermotoga maritima UPF0092 membrane protein TM_0859(TM_0859)
Recombinant Thermotoga maritima UPF0092 membrane protein TM_0859(TM_0859)
SKU:CSB-CF893045TNJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Uniprot NO.:Q9WZW3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPEIIYAAAPGASNGTTTTATGGGWGSLLFMLIFFIAIFYFMIILPQRRREKQFQQMISQ MKRGDTVVTIGGIVGKVIDIKKDTVKIKTANSTELEITKRAISTVIKERSQENQEG
Protein Names:Recommended name: UPF0092 membrane protein TM_0859
Gene Names:Ordered Locus Names:TM_0859
Expression Region:1-116
Sequence Info:full length protein
