Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 3(ctaE)

Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 3(ctaE)

SKU:CSB-CF015074TNI

Regular price $1,804.00 USD
Regular price Sale price $1,804.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thermosynechococcus vulcanus (Synechococcus vulcanus)

Uniprot NO.:P50677

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQGTVESQGTAIAVDHAHEHPDFRVLGLLVFLISESLMFGGLFAAYLLLRGMHEQWPPEG TEVELFVPTINTLILISSSFVIHYGDVAIKKDDVRGMRKWYWITAAMGAVFLGGQVYEYL TLGYGLRTNVFANCFYVMTGFHGLHVFIGILLILGVIWRSRRPGHYNAQKHTGVAMAEIY WHFVDVIWIILFTLLYILTRF

Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 3 Cytochrome c oxidase polypeptide III Oxidase aa(3) subunit 3

Gene Names:Name:ctaE

Expression Region:1-201

Sequence Info:full length protein

View full details