Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermoplasma volcanium UPF0290 protein TV0187(TV0187)

Recombinant Thermoplasma volcanium UPF0290 protein TV0187(TV0187)

SKU:CSB-CF850524TDL

Regular price $1,783.00 USD
Regular price Sale price $1,783.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)

Uniprot NO.:Q97CB5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNYPLLMAQAIILFVPALIANSGAVLTGGYFVLDRGKNFIDGRRILGDGKTLSGYLGGSF IGIVSGVIIYWISYATHFILGNYGSIALSIEIPAVMAFGSLTGDILGSFVKRRIGIKSGG KGGLLDQWPFALVAFLFLFLMERPFFLHYYFFAGIIVILAIVPPLHRAVNIIGYKLHKKD VPW

Protein Names:Recommended name: UPF0290 protein TV0187

Gene Names:Ordered Locus Names:TV0187 ORF Names:TVG0192666

Expression Region:1-183

Sequence Info:full length protein

View full details