
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Talpa europaea (European mole)
Uniprot NO.:O77740
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SIAFSRAVFAEFLATLIFVFFGLGSALNWQQSLPSVLQIAMAFGLAIGTLVQALGHISGA HINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEVTPSDVRG
Protein Names:Recommended name: Aquaporin-2 Short name= AQP-2 Alternative name(s): ADH water channel Aquaporin-CD Short name= AQP-CD Collecting duct water channel protein WCH-CD Water channel protein for renal collecting duct
Gene Names:Name:AQP2
Expression Region:1-109
Sequence Info:full length protein