Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Uniprot NO.:A0LJM1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIVPFGHVLLLAGALFGLGVFCAVARRNLIMIVLGVEIMLNAASIAFIGAAARWQSMEGQ AFVLFILAVAATEVSIGLAIIVYAFRRTGSFDPAAYNLMKAGDAMQSFERRGPQ
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 2 NDH-1 subunit K 2
Gene Names:Name:nuoK2 Ordered Locus Names:Sfum_1938
Expression Region:1-114
Sequence Info:full length protein