Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synechocystis sp. Uncharacterized protein sll1147 (sll1147)

Recombinant Synechocystis sp. Uncharacterized protein sll1147 (sll1147)

SKU:CSB-CF303326SSQ

Regular price $1,728.00 USD
Regular price Sale price $1,728.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechocystis sp. (strain PCC 6803 / Kazusa)

Uniprot NO.:P73795

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKTELLWPALITALATMLYLVLVINVGRARAKYGVMPPATTGNEDFERVLRVQYNTLEQ LAFFLPGLWLFAIYRDPTIAAILGAVWLLGRILYAWGYYQAAEKRMVGFALGSLSSMILV VGALLSILWQLRQLSQF

Protein Names:Recommended name: Uncharacterized protein sll1147

Gene Names:Ordered Locus Names:sll1147

Expression Region:1-137

Sequence Info:full length protein

View full details