Gene Bio Systems
Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit(petC)
Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit(petC)
SKU:CSB-CF683691FPZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Uniprot NO.:Q5N5B0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTQVSGASDVPSMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPSSGGSGGGVAAKDAL GNDVVLSKFLADHNVGDRTLVQGLKGDPTYLVVESSEAIGDYGINAVCTHLGCVVPWNAS ENKFKCPCHGSQYDATGKVVRGPAPLSLALAHVSVTDDKVFLSPWTETDFRTGDNPWWA
Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein Short name= ISP Short name= RISP Rieske iron-sulfur protein
Gene Names:Name:petC Ordered Locus Names:syc0318_d
Expression Region:1-179
Sequence Info:full length protein
