Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit(petC)

Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit(petC)

SKU:CSB-CF607962SAAP

Regular price $1,776.00 USD
Regular price Sale price $1,776.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechococcus sp. (strain CC9311)

Uniprot NO.:Q0I872

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTQMPASDVPGMGRRQFMNLLTFGSVTGVALGALYPVANYFIPPRAAGGGGGTSAKDELG NSVTASGWLSSHAEGDRSLVQGLKGDPTYLIVEGVDAIGSYGINAICTHLGCVVPWNSGA NKFMCPCHGSQYDATGKVVRGPAPLSLALANVSVDNDNVFVSQWTETDFRTGEKPWWS

Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein Short name= ISP Short name= RISP Rieske iron-sulfur protein

Gene Names:Name:petC Ordered Locus Names:sync_2149

Expression Region:1-178

Sequence Info:full length protein

View full details