Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synechococcus elongatus Protein SrpB(srpB)

Recombinant Synechococcus elongatus Protein SrpB(srpB)

SKU:CSB-CF706924FPY

Regular price $1,781.00 USD
Regular price Sale price $1,781.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Uniprot NO.:Q55026

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVIFLPQGDWLGLSFRLLLAMLVGAVIGLNRQRGGRPAGMRTFTLVAMGSALFVMVPIQ AEGDSSFAAINALSRTVQGVAAGVGFLGAGLILQRAPKTKRSGRPRVSGLTTAATIWITA ALGAVIGCGLWQLGLIGTFFTLLTLSGFKRLQRIAWLRQSWERLIAWEAKTLPPDAEEED DD

Protein Names:Recommended name: Protein SrpB

Gene Names:Name:srpB Ordered Locus Names:Synpcc7942_B2621 ORF Names:pANL47

Expression Region:1-182

Sequence Info:full length protein

View full details