Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus islandicus UPF0290 protein M1627_1414 (M1627_1414)

Recombinant Sulfolobus islandicus UPF0290 protein M1627_1414 (M1627_1414)

SKU:CSB-CF502882FPD

Regular price $1,761.00 USD
Regular price Sale price $1,761.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus islandicus (strain M.16.27)

Uniprot NO.:C3N5M2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW

Protein Names:Recommended name: UPF0290 protein M1627_1414

Gene Names:Ordered Locus Names:M1627_1414

Expression Region:1-166

Sequence Info:full length protein

View full details