Recombinant Sulfolobus islandicus filamentous virus  Putative transmembrane protein 74(SIFV0074)

Recombinant Sulfolobus islandicus filamentous virus Putative transmembrane protein 74(SIFV0074)

CSB-CF838612SUY
Regular price
$1,072.00 USD
Sale price
$1,072.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)

Uniprot NO.:Q914F8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNYFSVIMYLINSVIFTFMIFLTFVNPSLLNDQYWVYILIGFFTAIVFHSGYQAGKGSEK

Protein Names:Recommended name: Putative transmembrane protein 74

Gene Names:Name:SIFV0074

Expression Region:1-60

Sequence Info:full length protein