Gene Bio Systems
Recombinant Sulfolobus islandicus filamentous virus Putative transmembrane protein 10(SIFV0010)
Recombinant Sulfolobus islandicus filamentous virus Putative transmembrane protein 10(SIFV0010)
SKU:CSB-CF838620SUY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)
Uniprot NO.:Q914M0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNNFSYFSTIFSIALMSSNAFAGNDTLLVGFCPCIEINTLTLFLSSLYAIKPSDSCSPSY TSNLLNLFCDFVNSSTHLSISVFSSSVLSCFTSCFVIYFYPFFVFDSASYCVFNSSSREG CTSVTIGWG
Protein Names:Recommended name: Putative transmembrane protein 10
Gene Names:Name:SIFV0010
Expression Region:1-129
Sequence Info:full length protein
