Skip to product information
1 of 1

Gene Bio Systems

Recombinant Suid herpesvirus 1 Glycoprotein N(GN)

Recombinant Suid herpesvirus 1 Glycoprotein N(GN)

SKU:CSB-CF769819SRI

Regular price $1,668.00 USD
Regular price Sale price $1,668.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Suid herpesvirus 1 (strain Kaplan) (SuHV-1) (Pseudorabies virus (strain Kaplan))

Uniprot NO.:Q87088

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SIVSTEGPLPLLREESRINFWNAACAARGVPVDQPTAAAVTFYICLLAVLVVALGYATRT CTRMLHASPAGRRV

Protein Names:Recommended name: Glycoprotein N Short name= gN

Gene Names:Name:GN ORF Names:UL49.5

Expression Region:25-98

Sequence Info:full length protein

View full details