Skip to product information
1 of 1

Gene Bio Systems

Recombinant Structural protein VP3(VP3)

Recombinant Structural protein VP3(VP3)

SKU:CSB-CF764925SHAH

Regular price $1,517.00 USD
Regular price Sale price $1,517.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus virus-like particle SSV2

Uniprot NO.:Q6UG62

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEELNIKQILFLAIFLVIGVVLFQPIISYVNNVTTSGTYTTIISGTLTQTSFVSNPNYVG SSNAPLVSLVPLFYLIVLIVVPAVVAYKIYKD

Protein Names:Recommended name: Structural protein VP3

Gene Names:Name:VP3

Expression Region:1-92

Sequence Info:full length protein

View full details