Skip to product information
1 of 1

Gene Bio Systems

Recombinant Striga asiatica Casparian strip membrane protein 1

Recombinant Striga asiatica Casparian strip membrane protein 1

SKU:CSB-CF631238SBAR

Regular price $1,790.00 USD
Regular price Sale price $1,790.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Striga asiatica (Asiatic witchweed) (Striga lutea)

Uniprot NO.:Q1W3A5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKNESSAIEIAESSKERKGKAPLLAAAVGHDRAAGYKRGVSIFDLILRISAATAALAAT IVMGTTEQTLPFFTQFFQFRAQYDDLPTFTFFVVGMAIVTGYLILSVPLSIVCIARPVAI GPRFLLIVCDTVTAVLATSAAGSSAAIVYLAHNGNSDANWLAICQQFNDFCQRVSGAVVA AFVAVVCSS

Protein Names:Recommended name: Casparian strip membrane protein 1

Gene Names:

Expression Region:1-189

Sequence Info:full length protein

View full details