Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptomyces coelicolor Probable cytochrome c oxidase polypeptide 4(ctaF)

Recombinant Streptomyces coelicolor Probable cytochrome c oxidase polypeptide 4(ctaF)

SKU:CSB-CF895393FOB

Regular price $1,721.00 USD
Regular price Sale price $1,721.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

Uniprot NO.:Q9X812

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKIQGKMFIWLSVFILAVAVVYGYWSKEPAGTTALFLAFGLAIMIGFYLAFTARRVDAGA QDDMEADVADEAGEVGFFSPHSWQPLSLAVGGALAFLGIAVGWWVMYFSAPILMVGLFGW VFEYYRGENRTQ

Protein Names:Recommended name: Probable cytochrome c oxidase polypeptide 4 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 4 Cytochrome c oxidase polypeptide IV

Gene Names:Name:ctaF Ordered Locus Names:SCO2154 ORF Names:SC6G10.27c

Expression Region:1-132

Sequence Info:full length protein

View full details