Gene Bio Systems
Recombinant Streptomyces coelicolor NADH-quinone oxidoreductase subunit K 1(nuoK1)
Recombinant Streptomyces coelicolor NADH-quinone oxidoreductase subunit K 1(nuoK1)
SKU:CSB-CF875397FOB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Uniprot NO.:Q9F2V6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHLAYPAVLSALLFCTGLYGVLARRNAILVLMSVELMLNAVNLNLVAFDVWLSRAAEETL HSGQALTLFTIAIAAAEIGIGLAIVLAVHRNRGTSDIDKLRDTAEGHEPDGPDTDTPATG TAAEKAEATA
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 1 NDH-1 subunit K 1
Gene Names:Name:nuoK1 Ordered Locus Names:SCO4605 ORF Names:SCD39.05
Expression Region:1-130
Sequence Info:full length protein
