Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptomyces coelicolor NADH-quinone oxidoreductase subunit K 1(nuoK1)

Recombinant Streptomyces coelicolor NADH-quinone oxidoreductase subunit K 1(nuoK1)

SKU:CSB-CF875397FOB

Regular price $1,755.00 USD
Regular price Sale price $1,755.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

Uniprot NO.:Q9F2V6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHLAYPAVLSALLFCTGLYGVLARRNAILVLMSVELMLNAVNLNLVAFDVWLSRAAEETL HSGQALTLFTIAIAAAEIGIGLAIVLAVHRNRGTSDIDKLRDTAEGHEPDGPDTDTPATG TAAEKAEATA

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 1 NDH-1 subunit K 1

Gene Names:Name:nuoK1 Ordered Locus Names:SCO4605 ORF Names:SCD39.05

Expression Region:1-130

Sequence Info:full length protein

View full details