Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Uniprot NO.:O54189
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSRNTRINALLLLAVAALAVLPLVLGLGDHKEEPFAGADAEAETAITEIEPDYEPWFSPL HEPPSGEVESALFALQAALGAGVLAYYFGLRRGRRQGEERASAASGAAAAPGDAPEGD
Protein Names:Recommended name: Cobalt transport protein CbiN Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiN Short name= ECF transporter S component CbiN
Gene Names:Name:cbiN Ordered Locus Names:SCO5960 ORF Names:SC7H1.30c
Expression Region:1-118
Sequence Info:full length protein