Skip to product information
1 of 1

GeneBio Systems

Recombinant Streptomyces avidinii Streptavidin

Recombinant Streptomyces avidinii Streptavidin

SKU:P22629

Regular price $1,033.00 USD
Regular price Sale price $1,033.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P22629

Gene Names: N/A

Alternative Name(s): ; Streptavidin

Abbreviation: Recombinant Streptomyces avidinii Streptavidin protein

Organism: Streptomyces avidinii

Source: E.coli

Expression Region: 25-183aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal GST-tagged

Target Protein Sequence: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

MW: 43.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).

Reference: Structural studies of binding site tryptophan mutants in the high-affinity streptavidin-biotin complex.Freitag S., le Trong I., Chilkoti A., Klumb L.A., Stayton P.S., Stenkamp R.E.J. Mol. Biol. 279: 211-221(1998)

Function: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).

View full details