Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7-L12(rplL)

Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7-L12(rplL)

CSB-EP730328SMZ
Regular price
$795.00 USD
Sale price
$795.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: rplL

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)

Delivery time: 3-7 business days

Uniprot ID: Q5XCB4

AA Sequence: MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-121aa

Protein length: Full Length

MW: 32.3 kDa

Alternative Name(s):

Relevance: Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.

Reference: "Progress toward characterization of the group A Streptococcus metagenome: complete genome sequence of a macrolide-resistant serotype M6 strain." Banks D.J., Porcella S.F., Barbian K.D., Beres S.B., Philips L.E., Voyich J.M., DeLeo F.R., Martin J.M., Somerville G.A., Musser J.M. J. Infect. Dis. 190:727-738(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share