Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pneumoniae UPF0397 protein SPN23F04390 (SPN23F04390)

Recombinant Streptococcus pneumoniae UPF0397 protein SPN23F04390 (SPN23F04390)

SKU:CSB-CF495087FMY

Regular price $1,783.00 USD
Regular price Sale price $1,783.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)

Uniprot NO.:B8ZLW2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVG LIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVFDWKDILIFNLIQLLAN ALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLK KD

Protein Names:Recommended name: UPF0397 protein SPN23F04390

Gene Names:Ordered Locus Names:SPN23F04390

Expression Region:1-182

Sequence Info:full length protein

View full details