Recombinant Streptococcus pneumoniae Immunoglobulin A1 protease (iga), partial

SKU: Q54875

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q54875

Gene Names: iga

Alternative Name(s): (IgA1 protease)(IgA-specific zinc metalloproteinase)

Abbreviation: Recombinant Streptococcus pneumoniae iga protein, partial

Organism: Streptococcus pneumoniae

Source: E.coli

Expression Region: 313-393aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: NKPELLYREETIETKIDFQEEIQENPDLAEGTVRVKQEGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIVEKGTKK

MW: 16.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Zinc metalloproteinase which cleaves human immunoglobulin A1 (IgA1) in the hinge region, rendering it less efficient in coating the surface of colonizing or invading pneumococci. May be responsible for pneumococcal infection and is potentially involved in distinct stages of pneumococcal disease.

Reference: "Streptococcus pneumoniae G5 domains bind different ligands." Paukovich N., Redzic J.S., Chi Y.C., Rahkola J.T., Issaian A., Blue A., Hansen K.C., Janoff E.N., Eisenmesser E.Z. Protein Sci 28: 1797-1805(2019)

Function: