Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylothermus marinus UPF0290 protein Smar_0617 (Smar_0617)

Recombinant Staphylothermus marinus UPF0290 protein Smar_0617 (Smar_0617)

SKU:CSB-CF385224SUP

Regular price $1,774.00 USD
Regular price Sale price $1,774.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1)

Uniprot NO.:A3DM64

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGYMISPEYYFIYWFLKYYLSPMIANASPVLVKGIHRIDFSHIFIDGKPLFGKNKTWEG FYVGVLMGFLTSIGIGIILCEEEYILIGLGSSIFALIGDLLGSFIKRRMNIASGEPLPII DQLDFALMATLYYYFLGIEEFISYPLYILYSLIIILALHIITNNIAYYLGVKDKRW

Protein Names:Recommended name: UPF0290 protein Smar_0617

Gene Names:Ordered Locus Names:Smar_0617

Expression Region:1-176

Sequence Info:full length protein

View full details