Recombinant Staphylococcus haemolyticus  Putative antiporter subunit mnhC2(mnhc2)

Recombinant Staphylococcus haemolyticus Putative antiporter subunit mnhC2(mnhc2)

CSB-CF679721SBAH
Regular price
$1,077.00 USD
Sale price
$1,077.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus haemolyticus (strain JCSC1435)

Uniprot NO.:Q4L445

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLILLLVIGFLVFIGTYMILSLNLIRIVIGISIYTHAGNLIIMSMGHYSNKMTEPLIHG SNTNYVDPLLQAIVLTAIVIGFAMTAFLLVLVYRTYRVTKEANIDVLRGEEDENEQ

Protein Names:Recommended name: Putative antiporter subunit mnhC2 Alternative name(s): Mrp complex subunit C2 Putative NADH-ubiquinone oxidoreductase subunit mnhC2

Gene Names:Name:mnhc2 Synonyms:mrpC2 Ordered Locus Names:SH2273

Expression Region:1-116

Sequence Info:full length protein