Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus carnosus UPF0316 protein Sca_1484 (Sca_1484)

Recombinant Staphylococcus carnosus UPF0316 protein Sca_1484 (Sca_1484)

SKU:CSB-CF493882FLK

Regular price $1,789.00 USD
Regular price Sale price $1,789.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus carnosus (strain TM300)

Uniprot NO.:B9DMS4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVISANPWLMLLAIFVINVAYVTCLTVRTILTLKGYRYVAAAVSFIEVLIYIIGLGLVM ANLDKFQNIIAYALGFSVGIIVGMKIEEKLALGYSVVNVTTANYELDLPTQLRNLGYGVT HFPAYGRDGERLVMQILTPRRFELKLMDTIKQIDEKAFVIAYEARTLHGGFWVKGVRSKK LKAYDTDEI

Protein Names:Recommended name: UPF0316 protein Sca_1484

Gene Names:Ordered Locus Names:Sca_1484

Expression Region:1-189

Sequence Info:full length protein

View full details