Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0344 protein SAUSA300_0872(SAUSA300_0872)

Recombinant Staphylococcus aureus UPF0344 protein SAUSA300_0872(SAUSA300_0872)

SKU:CSB-CF640132SKZ

Regular price $1,718.00 USD
Regular price Sale price $1,718.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain USA300)

Uniprot NO.:Q2FIA6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PISKLFGIG

Protein Names:Recommended name: UPF0344 protein SAUSA300_0872

Gene Names:Ordered Locus Names:SAUSA300_0872

Expression Region:1-129

Sequence Info:full length protein

View full details