Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0344 protein SACOL0974(SACOL0974)

Recombinant Staphylococcus aureus UPF0344 protein SACOL0974(SACOL0974)

SKU:CSB-CF702235FLB

Regular price $1,716.00 USD
Regular price Sale price $1,716.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain COL)

Uniprot NO.:Q5HHB5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PISKLFGIG

Protein Names:Recommended name: UPF0344 protein SACOL0974

Gene Names:Ordered Locus Names:SACOL0974

Expression Region:1-129

Sequence Info:full length protein

View full details