Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0316 protein SAS1835(SAS1835)

Recombinant Staphylococcus aureus UPF0316 protein SAS1835(SAS1835)

SKU:CSB-CF743234SKW

Regular price $1,857.00 USD
Regular price Sale price $1,857.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain MSSA476)

Uniprot NO.:Q6G821

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK

Protein Names:Recommended name: UPF0316 protein SAS1835

Gene Names:Ordered Locus Names:SAS1835

Expression Region:1-200

Sequence Info:full length protein

View full details