Gene Bio Systems
Recombinant Staphylococcus aureus UPF0060 membrane protein SAS2231(SAS2231)
Recombinant Staphylococcus aureus UPF0060 membrane protein SAS2231(SAS2231)
SKU:CSB-CF753345SKW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain MSSA476)
Uniprot NO.:Q6G6Y2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA
Protein Names:Recommended name: UPF0060 membrane protein SAS2231
Gene Names:Ordered Locus Names:SAS2231
Expression Region:1-108
Sequence Info:full length protein
