Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0060 membrane protein SAS2231(SAS2231)

Recombinant Staphylococcus aureus UPF0060 membrane protein SAS2231(SAS2231)

SKU:CSB-CF753345SKW

Regular price $1,690.00 USD
Regular price Sale price $1,690.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain MSSA476)

Uniprot NO.:Q6G6Y2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA

Protein Names:Recommended name: UPF0060 membrane protein SAS2231

Gene Names:Ordered Locus Names:SAS2231

Expression Region:1-108

Sequence Info:full length protein

View full details