Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Protein translocase subunit SecG(SAOUHSC_00801)

Recombinant Staphylococcus aureus Protein translocase subunit SecG(SAOUHSC_00801)

SKU:CSB-CF643012FLF

Regular price $1,669.00 USD
Regular price Sale price $1,669.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain NCTC 8325)

Uniprot NO.:Q2G026

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIYYLSYIRNGGQFMHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQK QRGVDLFLNRLTIILSILFFVLMICISYLGM

Protein Names:Recommended name: Protein translocase subunit SecG

Gene Names:Ordered Locus Names:SAOUHSC_00801

Expression Region:1-91

Sequence Info:full length protein

View full details