Gene Bio Systems
Recombinant Staphylococcus aureus Protein CrcB homolog 1(crcB1)
Recombinant Staphylococcus aureus Protein CrcB homolog 1(crcB1)
SKU:CSB-CF683071FLB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain COL)
Uniprot NO.:Q5HEZ3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHRQFLSSRCQNLFFKFKLLLFEVNQMQYVYIFIGGALGALLRYLISFLNTDGGFPIGTL IANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFIT LLLYAVTSYVFGILLCYVGIKLGGGLS
Protein Names:Recommended name: Protein CrcB homolog 1
Gene Names:Name:crcB1 Ordered Locus Names:SACOL1832
Expression Region:1-147
Sequence Info:full length protein
