Gene Bio Systems
Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit B1
Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit B1
SKU:CSB-CF351543SKY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain N315)
Uniprot NO.:P60677
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE
Protein Names:Recommended name: Na(+)/H(+) antiporter subunit B1 Alternative name(s): Mnh complex subunit B1
Gene Names:Name:mnhB1 Ordered Locus Names:SA0812
Expression Region:1-142
Sequence Info:full length protein
