![Recombinant Staphylococcus aureus Leukocidin-F subunit(lukF)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_4309d847-08c7-42ca-b7d3-1cf7cbf3e4f8_{width}x.jpg?v=1659192202)
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: lukF
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Staphylococcus aureus
Delivery time: 3-7 business days
Uniprot ID: P31715
AA Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 26-323aa
Protein length: Full Length of Mature Protein
MW: 54 kDa
Alternative Name(s): Gamma-hemolysin, H-gamma-I subunit
Relevance: Leukocidin causes cytotoxic changes in polymorphonuclear leukocytes. Gamma-hemolysin causes hemolysis in red blood cells.
Reference: "The two Staphylococcal bi-component toxins, leukocidin and gamma-hemolysin, share one component in common." Kamio Y., Rahman A., Nariya H., Ozawa T., Izaki K. FEBS Lett. 321:15-18(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.