Gene Bio Systems
Recombinant Sporulation membrane protein ytrH(ytrH)
Recombinant Sporulation membrane protein ytrH(ytrH)
SKU:CSB-CF497039BRI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis
Uniprot NO.:C0H3P8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDQEAGFMVNFINSYFIALGVLIGGALIGGLGAYLAGEPPLTAITKLANRLKIWALVAAI GGTFDAVYSFERGILEGNTRDIFKQLLLIISAMGGAQSGWLIISWLTQEHLSS
Protein Names:Recommended name: Sporulation membrane protein ytrH
Gene Names:Name:ytrH Synonyms:spoVIGA Ordered Locus Names:BSU29239
Expression Region:1-113
Sequence Info:full length protein
