Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P00289
Gene Names: PETE
Organism: Spinacia oleracea (Spinach)
AA Sequence: VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Expression Region: 70-168aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 26.4 kDa
Alternative Name(s):
Relevance: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.
Reference: "Plastocyanin is encoded by an uninterrupted nuclear gene in spinach." Rother C., Jansen T., Tyagi A., Tittgen J., Herrmann R.G. Curr. Genet. 11:171-176(1986)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.