Gene Bio Systems
Recombinant Spinacia oleracea Photosystem I reaction center subunit VI, chloroplastic(PSAH)
Recombinant Spinacia oleracea Photosystem I reaction center subunit VI, chloroplastic(PSAH)
SKU:CSB-CF322106FKI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Spinacia oleracea (Spinach)
Uniprot NO.:P22179
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KYGDKSVYFDLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILG GGSLLTYVSANAPQDVLPITRGPQQPPKLGPRGKI
Protein Names:Recommended name: Photosystem I reaction center subunit VI, chloroplastic Short name= PSI-H Alternative name(s): Light-harvesting complex I 11 kDa protein
Gene Names:Name:PSAH
Expression Region:50-144
Sequence Info:full length protein
