Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sorghum bicolor Casparian strip membrane protein Sb10g008220 (Sb10g008220)

Recombinant Sorghum bicolor Casparian strip membrane protein Sb10g008220 (Sb10g008220)

SKU:CSB-CF510325FJS

Regular price $1,785.00 USD
Regular price Sale price $1,785.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sorghum bicolor (Sorghum) (Sorghum vulgare)

Uniprot NO.:C5Z7E3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKGSSEHGETSKAAPLGRGGVSKGVSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQF IRFKAQYSDLPTLTFFVVANSIVCAYLILSLPLSIVHIIRSRAKYSRLLLIFLDAAMLAL VTAGASAAAAIVYLAHKGNVRANWLAICQQFDSFCERISGSLIGSFGAMVMLILLILLSA IALARR

Protein Names:Recommended name: Casparian strip membrane protein Sb10g008220

Gene Names:Ordered Locus Names:Sb10g008220

Expression Region:1-186

Sequence Info:full length protein

View full details