
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Uniprot NO.:A9FGS9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLKSKLSLSAVVGTALVLVPAMALAQDGAASNKYDANSWLAVAAGFAIGIAALGGTMGQ GRAAAAALEGISRNPGAAARIQTPMILGLALIESLVLLSWVIAFFLQGKIAP
Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpE Ordered Locus Names:sce7980
Expression Region:1-112
Sequence Info:full length protein
You may also like
-
Recombinant Sorangium cellulosum ATP synthase subunit b(atpF)
- Regular price
- $1,711.00 USD
- Sale price
- $1,711.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sorangium cellulosum ATP synthase subunit a(atpB)
- Regular price
- $1,719.00 USD
- Sale price
- $1,719.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Clostridium cellulolyticum ATP synthase subunit c(atpE)
- Regular price
- $1,517.00 USD
- Sale price
- $1,517.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant ATP synthase subunit c(atpE)
- Regular price
- $1,513.00 USD
- Sale price
- $1,513.00 USD
- Regular price
-
- Unit price
- per
Sold out