Skip to product information
1 of 1

Gene Bio Systems

Recombinant Solanum tuberosum NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic(ndhG)

Recombinant Solanum tuberosum NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic(ndhG)

SKU:CSB-CF634650FIG

Regular price $1,774.00 USD
Regular price Sale price $1,774.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Solanum tuberosum (Potato)

Uniprot NO.:Q27RZ6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLICTSLFYILSNSYFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSW YGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 6 NADH-plastoquinone oxidoreductase subunit 6

Gene Names:Name:ndhG

Expression Region:1-176

Sequence Info:full length protein

View full details