Recombinant Sodalis glossinidius  Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)

Recombinant Sodalis glossinidius Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)

CSB-CF646786SBAA
Regular price
$1,081.00 USD
Sale price
$1,081.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sodalis glossinidius (strain morsitans)

Uniprot NO.:Q2NRW0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMYLLIFLVSLLSCAGQLCQKHAAGASSGAGELRHRVRWLAISLLLLGGAMLVWLWVLQR VPVGIAYPMFSLNFVLVTLAARWLWREPVSLRHGCGLLLIVAGVMCMGVNL

Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnE Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE

Gene Names:Name:arnE Ordered Locus Names:SG1840

Expression Region:1-111

Sequence Info:full length protein