Gene Bio Systems
Recombinant Shigella sonnei Protein CrcB homolog(crcB)
Recombinant Shigella sonnei Protein CrcB homolog(crcB)
SKU:CSB-CF672422SGI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella sonnei (strain Ss046)
Uniprot NO.:Q3Z4G8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:SSON_0578
Expression Region:1-127
Sequence Info:full length protein
