Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shigella boydii serotype 18 UPF0059 membrane protein yebN(yebN)

Recombinant Shigella boydii serotype 18 UPF0059 membrane protein yebN(yebN)

SKU:CSB-CF464620SYZ

Regular price $1,788.00 USD
Regular price Sale price $1,788.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Uniprot NO.:B2U461

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG

Protein Names:Recommended name: UPF0059 membrane protein yebN

Gene Names:Name:yebN Ordered Locus Names:SbBS512_E2088

Expression Region:1-188

Sequence Info:full length protein

View full details