Recombinant Shigella boydii serotype 18  Fumarate reductase subunit D(frdD)

Recombinant Shigella boydii serotype 18 Fumarate reductase subunit D(frdD)

CSB-CF450952SYZ
Regular price
$1,091.00 USD
Sale price
$1,091.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Uniprot NO.:B2TY29

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MINPNPKHSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGIVTI

Protein Names:Recommended name: Fumarate reductase subunit D Alternative name(s): Fumarate reductase 13 kDa hydrophobic protein

Gene Names:Name:frdD Ordered Locus Names:SbBS512_E4683

Expression Region:1-119

Sequence Info:full length protein