
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shewanella sp. (strain W3-18-1)
Uniprot NO.:A1REF8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MINYSPKRSDEPIWWGLFGAGGVWFAMITPVTVLLMGILLPLHGFGVVDIGYDKVYAFVS HPIGGAFTVLSLSLPMWHAMHRVHHGLHDLQIHLGTVGKYACYLAAALVTVLATVWVIQL S
Protein Names:Recommended name: Fumarate reductase subunit D
Gene Names:Name:frdD Ordered Locus Names:Sputw3181_0201
Expression Region:1-121
Sequence Info:full length protein