Gene Bio Systems
Recombinant Shewanella putrefaciens UPF0114 protein Sputcn32_0673 (Sputcn32_0673)
Recombinant Shewanella putrefaciens UPF0114 protein Sputcn32_0673 (Sputcn32_0673)
SKU:CSB-CF397561STQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Uniprot NO.:A4Y370
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHVLPIIFEMREVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMNVENISNDKIMWYLLIHITFVLSAFAMGYLDKITRK
Protein Names:Recommended name: UPF0114 protein Sputcn32_0673
Gene Names:Ordered Locus Names:Sputcn32_0673
Expression Region:1-162
Sequence Info:full length protein
