Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella loihica Electron transport complex protein RnfA(rnfA)

Recombinant Shewanella loihica Electron transport complex protein RnfA(rnfA)

SKU:CSB-CF388958STO

Regular price $1,793.00 USD
Regular price Sale price $1,793.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shewanella loihica (strain ATCC BAA-1088 / PV-4)

Uniprot NO.:A3QEN4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEYLLLLVGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVD TYLLTPFDLSYLRTMAFILVIAVVVQFTEMLVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIESAIYGFGAAVGFSIVLILFSAMRERLAAADVPAPFKGGAIAMITAGLM SLAFMGFTGLVN

Protein Names:Recommended name: Electron transport complex protein RnfA

Gene Names:Name:rnfA Ordered Locus Names:Shew_2066

Expression Region:1-192

Sequence Info:full length protein

View full details