Gene Bio Systems
Recombinant Sheep Neuropeptide Y receptor type 2(NPY2R)
Recombinant Sheep Neuropeptide Y receptor type 2(NPY2R)
SKU:CSB-CF016036SH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ovis aries (Sheep)
Uniprot NO.:P79211
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTVYSLLSLLILYVLPLGIIS FSYARIWSKLKNHVSPGAAHDHYHQR
Protein Names:Recommended name: Neuropeptide Y receptor type 2 Short name= NPY2-R Alternative name(s): NPY-Y2 receptor Short name= Y2 receptor
Gene Names:Name:NPY2R
Expression Region:1-146
Sequence Info:Full length protein
